Anti-FAM3A

family with sequence similarity 3 member A, Polyclonal, IgG, Rabbit

GeneName: FAM3A

Concentration: 0,05

Sequence: GFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIG

InterspeciesReactivity: ENSMUSG00000031399: 88%, ENSRNOG00000060623: 90%

Entrez Gene ID: 60343

Uniprot ID: P98173

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal FAM3A Antibody against Human FAM3 metabolism regulating signaling molecule A. Validated for Western Blot

• Artikelnummer: ATLHPA072305-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA072305-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 60343
• Wirt: Rabbit
• Konjugat: Unconjugated