Anti-INCA1

inhibitor of CDK, cyclin A1 interacting protein 1, Polyclonal, IgG, Rabbit

GeneName: INCA1

Concentration: 0,1

Sequence: QDDGVNLIPFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPTWLEEQHIPPMLLPPPEMLWRR

InterspeciesReactivity: ENSMUSG00000057054: 55%, ENSRNOG00000037418: 55%

Entrez Gene ID: 388324

Uniprot ID: Q0VD86

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal INCA1 Antibody against Human inhibitor of CDK, cyclin A1 interacting protein 1. Validated for Western Blot

• Artikelnummer: ATLHPA024202-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA024202-25
• Verpackungseinheit: 25UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 388324
• Wirt: Rabbit
• Konjugat: Unconjugated