Anti-ING1

inhibitor of growth family member 1, Polyclonal, IgG, Rabbit

GeneName: ING1

Concentration: 0,05

Sequence: MSFVECPYHSPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGSLGLQPWIGSSRC

InterspeciesReactivity: ENSMUSG00000028786: 23%, ENSRNOG00000011151: 24%

Entrez Gene ID: 3621

Uniprot ID: Q9UK53

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal ING1 Antibody against Human inhibitor of growth family member 1. Validated for Western Blot

• Artikelnummer: ATLHPA071589-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA071589-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 3621
• Wirt: Rabbit
• Konjugat: Unconjugated