Anti-LNX2

ligand of numb-protein X 2, Polyclonal, IgG, Rabbit

GeneName: LNX2

Concentration: 0,2

Sequence: SVCKDVMQRCDLEAHLKNRCPGASHRRVALERRKTSRTQAEIENENGPTLLDPAGTLSPEADCLGTGAVPVERHLTSAS

InterspeciesReactivity: ENSMUSG00000016520: 75%, ENSRNOG00000000955: 68%

Entrez Gene ID: 222484

Uniprot ID: Q8N448

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal LNX2 Antibody against Human ligand of numb-protein X 2. Validated for Western Blot

• Artikelnummer: ATLHPA071073-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA071073-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 222484
• Wirt: Rabbit
• Konjugat: Unconjugated