Anti-LRRIQ4

leucine rich repeats and IQ motif containing 4, Polyclonal, IgG, Rabbit

Sequence: TDLKEIPVVIFKNLHHLELLGLTGNHLKCLPKEIVNQTKLREIYLKRNQFEVFPQELCVLYTLEIIDLDENKIGAIPEEIGHLTGLQKFYMASNNL

GeneName: LRRIQ4

Ensembl Gene ID: ENSG00000188306

UniProt ID: A6NIV6

Entrez Gene ID: 344657

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.3

Interspecies Mouse/Rat: ENSRNOG00000009004: 70%, ENSMUSG00000027703: 71%

Enhanced Validation: No

• Artikelnummer: ATLHPA036271-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA036271-25
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 344657
• Wirt: Rabbit
• Konjugat: Unconjugated