Anti-MCTP2

multiple C2 and transmembrane domain containing 2, Polyclonal, IgG, Rabbit

GeneName: MCTP2

Concentration: 0,05

Sequence: RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW

InterspeciesReactivity: ENSMUSG00000032776: 96%, ENSRNOG00000009932: 94%

Entrez Gene ID: 55784

Uniprot ID: Q6DN12

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal MCTP2 Antibody against Human multiple C2 and transmembrane domain containing 2. Validated for Western Blot

• Artikelnummer: ATLHPA054752-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA054752-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 55784
• Wirt: Rabbit
• Konjugat: Unconjugated