Anti-OPG (AbAb02OPG)

Anti-OPG [AbAb02OPG], Recombinant, IgG1 kappa, Mouse
Artikelnummer
ABAAb04114-1.1-BT
Verpackungseinheit
1 mg
Hersteller
Absolute Antibody

Verfügbarkeit: wird geladen...
Preis wird geladen...
CloneID: AbAb02OPG

Antigen Long Description: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG C-terminal epitope (HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL).

Buffer Composition: PBS only.

Uniprot Accession No.: O00300

Specificity Statement: This antibody is specific for the C-terminal epitope of OPG.

Application Notes (Clone): This antibody was generated as a detection antibody that binds to the C-terminal epitope of OPG, as verified by an ELISA. This antibody and the corresponding capture antibody (AbAb01OPG) were used to create an OPG detection kit, which demonstrated a good correlation with a control OPG kit in detecting OPG concentrations in serum samples (CN113621060A).
Mehr Informationen
Artikelnummer ABAAb04114-1.1-BT
Hersteller Absolute Antibody
Hersteller Artikelnummer Ab04114-1.1-BT
Verpackungseinheit 1 mg
Mengeneinheit STK
Reaktivität Human
Klonalität Recombinant
Methode ELISA
Isotyp IgG1 kappa
Wirt Mouse
Produktinformation (PDF) Download
MSDS (PDF) Download