Anti-Phospholipase A2 (AbAb02-PLA2)

Anti-Phospholipase A2 [AbAb02-PLA2], Recombinant, IgG-Fc Fusion, Rabbit
Artikelnummer
ABAAb04531-23.159-BT
Verpackungseinheit
1 mg
Hersteller
Absolute Antibody

Verfügbarkeit: wird geladen...
Preis wird geladen...
CloneID: AbAb02-PLA2

Antigen Long Description: A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generate this antibody. The actual sequence of the chimeric protein used for immunization was 'YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA'.

Buffer Composition: PBS only.

Chimeric Use Statement: This is a chimeric antibody, developed from the original camelid VHH antibody, specifically engineered for enhanced compatibility with existing reagents, assays, and techniques.

Specificity Statement: This antibody binds the phospholipase A2 protein found in the venom of Naja naja atra (Chinese cobra), Ophiophagus hannah (King cobra) and Bungarus fasciatus (Banded krait).

Application Notes (Clone): This antibody can be used for determination of PLA2 protein from snake venom of coral snakes, cobras and king cobra using ELISA.
Mehr Informationen
Artikelnummer ABAAb04531-23.159-BT
Hersteller Absolute Antibody
Hersteller Artikelnummer Ab04531-23.159-BT
Verpackungseinheit 1 mg
Mengeneinheit STK
Reaktivität Various species
Klonalität Recombinant
Methode ELISA
Isotyp IgG-Fc Fusion
Wirt Rabbit
Produktinformation (PDF)
×
MSDS (PDF) Download