Anti-Phospholipase A2 (AbAb02-PLA2)

Anti-Phospholipase A2 [AbAb02-PLA2], Recombinant, VHH, Camelid
Artikelnummer
ABAAb04531-34.11
Verpackungseinheit
100 μg
Hersteller
Absolute Antibody

Verfügbarkeit: wird geladen...
Preis wird geladen...
CloneID: AbAb02-PLA2

Heavy Chain modification: His-tagged

Antigen Long Description: A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generate this antibody. The actual sequence of the chimeric protein used for immunization was 'YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA'.

Buffer Composition: PBS with 0.02% Proclin 300.

Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7

Specificity Statement: This antibody binds the phospholipase A2 protein found in the venom of Naja naja atra (Chinese cobra), Ophiophagus hannah (King cobra) and Bungarus fasciatus (Banded krait).

Application Notes (Clone): This antibody can be used for determination of PLA2 protein from snake venom of coral snakes, cobras and king cobra using ELISA.
Mehr Informationen
Artikelnummer ABAAb04531-34.11
Hersteller Absolute Antibody
Hersteller Artikelnummer Ab04531-34.11
Verpackungseinheit 100 μg
Mengeneinheit STK
Reaktivität Various species
Klonalität Recombinant
Methode ELISA
Isotyp VHH
Wirt Camelid
Produktinformation (PDF)
×
MSDS (PDF) Download