Anti-RABEPK

Rab9 effector protein with kelch motifs, Polyclonal, IgG, Rabbit

Sequence: MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLLPRYEHASFIPSCTP

GeneName: RABEPK

Ensembl Gene ID: ENSG00000136933

UniProt ID: Q7Z6M1

Entrez Gene ID: 10244

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.05

Interspecies Mouse/Rat: ENSMUSG00000070953: 83%, ENSRNOG00000018591: 82%

Enhanced Validation: No

• Artikelnummer: ATLHPA024415-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA024415-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 10244
• Wirt: Rabbit
• Konjugat: Unconjugated