Anti-SOCS5

suppressor of cytokine signaling 5, Polyclonal, IgG, Rabbit

GeneName: SOCS5

Concentration: 0,3

Sequence: HSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQRLQDTVGLCFPMRTYSKQSKP

InterspeciesReactivity: ENSMUSG00000037104: 93%, ENSRNOG00000028504: 95%

Entrez Gene ID: 9655

Uniprot ID: O75159

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal SOCS5 Antibody against Human suppressor of cytokine signaling 5. Validated for Western Blot

• Artikelnummer: ATLHPA031964-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA031964-25
• Verpackungseinheit: 25UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 9655
• Wirt: Rabbit
• Konjugat: Unconjugated