Anti-SOS1

son of sevenless homolog 1 (Drosophila), Polyclonal, IgG, Rabbit

GeneName: SOS1

Concentration: 0,6

Sequence: EPGRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIP

InterspeciesReactivity: ENSMUSG00000024241: 97%, ENSRNOG00000007106: 98%

Entrez Gene ID: 6654

Uniprot ID: Q07889

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal SOS1 Antibody against Human SOS Ras/Rac guanine nucleotide exchange factor 1. Validated for Western Blot

• Artikelnummer: ATLHPA076088-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA076088-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 6654
• Wirt: Rabbit
• Konjugat: Unconjugated