Anti-SPG7

spastic paraplegia 7 (pure and complicated autosomal recessive), Polyclonal, IgG, Rabbit

GeneName: SPG7

Concentration: 0,1

Sequence: RKVTRIAYSMVKQFGMAPGIGPISFPEAQEGLMGIGRRPFSQGLQQMMDHEARLLVAKAYRHTEKVLQDNLDKL

InterspeciesReactivity: ENSMUSG00000000738: 95%, ENSRNOG00000015150: 93%

Entrez Gene ID: 6687

Uniprot ID: Q9UQ90

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal SPG7 Antibody against Human SPG7 matrix AAA peptidase subunit, paraplegin. Validated for Western Blot

• Artikelnummer: ATLHPA076114-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA076114-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 6687
• Wirt: Rabbit
• Konjugat: Unconjugated