Anti-VPS53

vacuolar protein sorting 53 homolog (S. cerevisiae), Polyclonal, IgG, Rabbit

GeneName: VPS53

Concentration: 0,1

Sequence: TRDIKQLDHAKRHLTTSITTLNHLHMLAGGVDSLEAMTRRRQYGEVANLLQGVMNVLEHFHKYMGIPQIRQLSERVKAAQTELGQQILADFEEAFP

InterspeciesReactivity: ENSMUSG00000017288: 100%, ENSRNOG00000006895: 100%

Entrez Gene ID: 55275

Uniprot ID: Q5VIR6

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal VPS53 Antibody against Human VPS53 subunit of GARP complex. Validated for Western Blot

• Artikelnummer: ATLHPA075763-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA075763-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 55275
• Wirt: Rabbit
• Konjugat: Unconjugated