Anti-WSB2

WD repeat and SOCS box containing 2, Polyclonal, IgG, Rabbit

GeneName: WSB2

Concentration: 0,05

Sequence: ALELKTPIAFAPMTNGLCCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMK

InterspeciesReactivity: ENSMUSG00000029364: 96%, ENSRNOG00000001135: 96%

Entrez Gene ID: 55884

Uniprot ID: Q9NYS7

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal WSB2 Antibody against Human WD repeat and SOCS box containing 2. Validated for Western Blot

• Artikelnummer: ATLHPA077139-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA077139-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 55884
• Wirt: Rabbit
• Konjugat: Unconjugated