AP2B1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: AP2B1 is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AP2B1

Key Reference: Schmid,E.M., PLoS Biol. 4 (9), E262 (2006)

Molecular Weight: 105kDa

Peptide Sequence: Synthetic peptide located within the following region: DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: AP-2 complex subunit beta

Protein Size: 951

Purification: Affinity Purified

Subunit: beta

• Artikelnummer: AVIARP53578_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53578_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 163
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin