APBB2 Antibody - middle region : FITC

APBB2 Antibody - middle region : FITC
Artikelnummer
AVIARP55624_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: APBB2 may modulate the internalization of beta-amyloid precursor protein.The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APBB2

Key Reference: Hong,Q., (er) BMC Mol. Biol. 8, 50 (2007)

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amyloid beta A4 precursor protein-binding family B member 2

Protein Size: 736

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55624_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55624_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 323
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×