APH1B Antibody - C-terminal region : Biotin

APH1B Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP53808_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a multi-pass transmembrane protein that is a functional component of the gamma-secretase complex, which also contains presenilin and nicastrin. This protein represents a stabilizing cofactor for the presenilin holoprotein in the complex. The gamma-secretase complex catalyzes the cleavage of integral proteins such as notch receptors and beta-amyloid precursor protein.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: YYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-secretase subunit APH-1B

Protein Size: 216

Purification: Affinity Purified

Subunit: APH-1B
Mehr Informationen
Artikelnummer AVIARP53808_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53808_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 83464
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×