APH1B Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a multi-pass transmembrane protein that is a functional component of the gamma-secretase complex, which also contains presenilin and nicastrin. This protein represents a stabilizing cofactor for the presenilin holoprotein in the complex. The gamma-secretase complex catalyzes the cleavage of integral proteins such as notch receptors and beta-amyloid precursor protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human APH1B

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: IIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Gamma-secretase subunit APH-1B

Protein Size: 257

Purification: Affinity Purified

• Artikelnummer: AVIARP53807_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53807_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 83464
• Wirt: Rabbit
• Konjugat: Conjugated, HRP