APIP Antibody - middle region : FITC

APIP Antibody - middle region : FITC
Artikelnummer
AVIARP56789_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: APIP is an APAF1 (MIM 602233)-interacting protein that acts as a negative regulator of ischemic/hypoxic injury (Cho et al., 2004 [PubMed 15262985]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APIP

Key Reference: Cho,D.H., (2004) J. Biol. Chem. 279 (38), 39942-39950

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: GIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable methylthioribulose-1-phosphate dehydratase

Protein Size: 242

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56789_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56789_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51074
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×