Apoa1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Apoa1 is a major component of high density lipoprotein (HDL) that is involved in intercellular cholesterol transport in astrocytes; cofactor for lecithin cholesterolacyltransferase (LCAT)。

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: LVFLTGCQAWEFWQQDEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apolipoprotein A-I

Protein Size: 259

Purification: Affinity Purified

• Artikelnummer: AVIARP54279_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54279_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 25081
• Wirt: Rabbit
• Konjugat: Conjugated, FITC