APOBEC4 Antibody - middle region : FITC

APOBEC4 Antibody - middle region : FITC
Artikelnummer
AVIARP55976_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APOBEC4

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: VRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEKKKKKGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative C->U-editing enzyme APOBEC-4

Protein Size: 367

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55976_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55976_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 403314
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×