APOBEC4 Antibody - N-terminal region : FITC

APOBEC4 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55975_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC4

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative C->U-editing enzyme APOBEC-4

Protein Size: 367

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55975_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55975_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 403314
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×