APOBEC4 Antibody - N-terminal region : HRP

APOBEC4 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55975_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC4

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative C->U-editing enzyme APOBEC-4

Protein Size: 367

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55975_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55975_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 403314
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×