APOE Antibody - N-terminal region : Biotin

APOE Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54284_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apolipoprotein E

Protein Size: 317

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54284_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54284_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Zebrafish
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 348
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×