APPL1 Antibody - middle region : Biotin

APPL1 Antibody - middle region : Biotin
Artikelnummer
AVIARP54834_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APPL1

Key Reference: McCrea,H.J., (2008) Biochem. Biophys. Res. Commun. 369 (2), 493-499

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: GQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DCC-interacting protein 13-alpha

Protein Size: 709

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54834_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54834_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26060
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×