AQP5 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Aquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AQP5

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: RFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aquaporin-5

Protein Size: 265

Purification: Affinity Purified

• Artikelnummer: AVIARP53592_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53592_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Sheep (Ovine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 362
• Wirt: Rabbit
• Konjugat: Conjugated, FITC