ARAF Antibody - middle region : Biotin

ARAF Antibody - middle region : Biotin
Artikelnummer
AVIARP54592_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARAF

Key Reference: Razzaque,M.A., (2007) Nat. Genet. 39 (8), 1013-1017

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase A-Raf

Protein Size: 606

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54592_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54592_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 369
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×