Arf4 Antibody - N-terminal region : Biotin

Arf4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56032_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Arf4 is an GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. It is Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP-ribosylation factor 4

Protein Size: 180

Purification: Affinity Purified

Specificity#: This antibody is predicted to react to human ARF1,3,4,5 (100% homology) and 6 (93%).
Mehr Informationen
Artikelnummer AVIARP56032_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56032_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11843
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×