ARFGAP1 Antibody - middle region : HRP

ARFGAP1 Antibody - middle region : HRP
Artikelnummer
AVIARP57150_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a GTPase-activating protein (GAP) which associates with the Golgi apparatus and which interacts with ADP-ribosylation factor 1 (ARF1). The encoded protein promotes hydrolysis of ARF1-bound GTP and is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is required for the fusion of these vesicles with target compartments. The activity of this protein is stimulated by phosphoinosides and inhibited by phosphatidylcholine. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARFGAP1

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: WRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADP-ribosylation factor GTPase-activating protein 1

Protein Size: 406

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57150_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57150_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55738
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×