ARFIP2 Antibody - middle region : FITC

ARFIP2 Antibody - middle region : FITC
Artikelnummer
AVIARP54459_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARFIP2 is a putative target protein of ADP-ribosylation factor. It is involved in membrane ruffling.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ARFIP2

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: CTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arfaptin-2

Protein Size: 256

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54459_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54459_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23647
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×