ARHGAP1 Antibody - N-terminal region : FITC

ARHGAP1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54722_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARHGAP1 is a GTPase activator for the Rho, Rac and Cdc42 proteins, converting them to the putatively inactive GDP-bound state. Cdc42 seems to be the preferred substrate.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 1

Protein Size: 439

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54722_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54722_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 392
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×