ARHGAP15 Antibody - middle region : Biotin

ARHGAP15 Antibody - middle region : Biotin
Artikelnummer
AVIARP57262_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP15

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 15

Protein Size: 475

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57262_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57262_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55843
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×