ARHGAP28 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: TKAKDILAKFQYENSHGSSECIKIQNQRLYEIGGNIGEHCLDPDAYILDV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 28

Protein Size: 570

Purification: Affinity Purified

• Artikelnummer: AVIARP53571_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53571_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79822
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin