ARHGAP28 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARHGAP28

Key Reference: Nusbaum,C., (2005) Nature 437 (7058), 551-555

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPKHVFLFTIGLD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho GTPase-activating protein 28

Protein Size: 563

Purification: Affinity Purified

• Artikelnummer: AVIARP53789_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53789_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79822
• Wirt: Rabbit
• Konjugat: Conjugated, HRP