ARHGAP28 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP28

Key Reference: Nusbaum,C., (2005) Nature 437 (7058), 551-555

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: KEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 28

Protein Size: 570

Purification: Affinity Purified

• Artikelnummer: AVIARP53570_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53570_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Dog (Canine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79822
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin