ARHGAP45 Antibody - N-terminal region : FITC

ARHGAP45 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54876_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human HMHA1

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: MMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: rho GTPase-activating protein 45

Protein Size: 771

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54876_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54876_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23526
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×