ARHGAP45 Antibody - N-terminal region : HRP

ARHGAP45 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54876_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human HMHA1

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: MMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: rho GTPase-activating protein 45

Protein Size: 771

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54876_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54876_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23526
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×