ARHGEF3 Antibody - N-terminal region : HRP

ARHGEF3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57339_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rho-like GTPases are involved in a variety of cellular processes, and they are activated by binding GTP and inactivated by conversion of GTP to GDP by their intrinsic GTPase activity. Guanine nucleotide exchange factors (GEFs) accelerate the GTPase activity of Rho GTPases by catalyzing their release of bound GDP. This gene encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in this gene plays a role in the determination of bone mineral density (BMD), indicating the implication of this gene in postmenopausal osteoporosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARHG3

Key Reference: N/A

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: VKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: rho guanine nucleotide exchange factor 3

Protein Size: 526

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP57339_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57339_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 50650
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×