ARL17 Antibody - middle region : HRP

ARL17 Antibody - middle region : HRP
Artikelnummer
AVIARP56258_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL17

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADP-ribosylation factor-like protein 17

Protein Size: 177

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56258_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56258_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 641522
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×