ARL5A Antibody - middle region : HRP

ARL5A Antibody - middle region : HRP
Artikelnummer
AVIARP55757_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARL5A lacks ADP-ribosylation enhancing activity.The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL5A

Key Reference: Wang,Z.X., (2005) Biochem. Biophys. Res. Commun. 332 (3), 640-645

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADP-ribosylation factor-like protein 5A

Protein Size: 179

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55757_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55757_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26225
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×