ARL8B Antibody - middle region : FITC

ARL8B Antibody - middle region : FITC
Artikelnummer
AVIARP57137_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARL8B may play a role in lysosome motility and chromosome segregation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL8B

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP-ribosylation factor-like protein 8B

Protein Size: 186

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57137_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57137_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55207
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×