ARMC4 Antibody - N-terminal region : HRP

ARMC4 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58586_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Molecular Weight: 115kDa

Peptide Sequence: Synthetic peptide located within the following region: NTSLAPSAFESGYVVSETTVKSEEVDKNGQPLLFLSVPQIKIRSFGQLSR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Armadillo repeat-containing protein 4

Protein Size: 1044

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58586_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58586_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55130
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×