ARSA Antibody - middle region : FITC

ARSA Antibody - middle region : FITC
Artikelnummer
AVIARP54529_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARSA hydrolyzes cerebroside sulfate. Defects in ARSA are a cause of leukodystrophy metachromatic (MLD).The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Multiple alternatively spliced transcript variants, one of which encodes a distinct protein, have been described for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARSA

Key Reference: Saito,S., (2008) Mol. Genet. Metab. 93 (4), 419-425

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arylsulfatase A

Protein Size: 507

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54529_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54529_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 410
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×