ASAH1 Antibody - N-terminal region : FITC

ASAH1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57760_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASAH1

Key Reference: Kim,H.L. (2008) Genetics 178 (3), 1505-1515

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acid ceramidase

Protein Size: 395

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57760_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57760_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 427
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×