ASB7 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquination and, therefore, for proteasome-mediated degradation. Two alternative transcripts encoding different isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ASB7

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat and SOCS box protein 7

Protein Size: 318

Purification: Affinity Purified

• Artikelnummer: AVIARP53463_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53463_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 140460
• Wirt: Rabbit
• Konjugat: Conjugated, FITC