ASH2L Antibody - N-terminal region : FITC

ASH2L Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58133_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ASH2L is a component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. It as part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. It may function as a transcriptional regulator. And it May play a role in hematopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ASH2L

Key Reference: N/A

Molecular Weight: 69 kDa

Peptide Sequence: Synthetic peptide located within the following region: GPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Set1/Ash2 histone methyltransferase complex subunit ASH2

Protein Size: 628

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP58133_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58133_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9070
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×