ASPA Antibody - N-terminal region : HRP

ASPA Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56072_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of SASP is not yet known.This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASPA

Key Reference: Le (2008) Biochemistry 47 (11), 3484-3492

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Aspartoacylase

Protein Size: 313

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56072_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56072_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 443
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×