Asrgl1 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Asrgl1 acts in asparagine catabolism. Asrgl1 may be involved in astroglial production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: ALFHVEQGKTVEEAAQLALDYMKSKLKGLGGLILVNKTGDWVAKWTSASM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: L-asparaginase

Protein Size: 326

Purification: Affinity Purified

• Artikelnummer: AVIARP53783_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53783_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 66514
• Wirt: Rabbit
• Konjugat: Conjugated, HRP