ASRGL1 Antibody - middle region : HRP

ASRGL1 Antibody - middle region : HRP
Artikelnummer
AVIARP53782_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ASGL1

Key Reference: N/A

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: NVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: isoaspartyl peptidase/L-asparaginase

Protein Size: 180

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP53782_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53782_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 80150
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×